PTM Viewer PTM Viewer

AT5G65165.1

Arabidopsis thaliana [ath]

succinate dehydrogenase 2-3

No PTMs currently found

PLAZA: AT5G65165
Gene Family: HOM05D002252
Other Names: SDH2-3

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 309

MSSVLRLLGRRICNPAAEKVRLSSSLSGGGDFPILNGHKAAQDLSKDTLKSQDITKEKEGQHKEVKKEFKIYRWNPDKPNSKPFLQSFFVDLSSCGPMVLDVLQKIKAEDDASLSYRRSCREGICGSCSMNIDGTNTVACLKPINPNTSKPTIITPLPHMYVIKDLVVDLTNFYQQYKSMEPWLKTRKPPKDGREHRQSPKDRKKLDGLYECILCACCTTSCPSYWWNPEEFPGPAALLQAYRWISDSRDEYREERLQAITESETKVYRCRAIKNCTATCPKGLNPASAILKMKSKHLLSDPLVRTESV

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR017896 202 232
IPR025192 69 174
Molecule Processing
Show Type From To
Transit Peptide 1 22
Sites
Show Type Position
Active Site 120
Active Site 125
Active Site 140
Active Site 212
Active Site 215
Active Site 218
Active Site 280
Active Site 222
Active Site 270
Active Site 276
Active Site 227

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here